Ver mas grande
Fgf9 (Mouse) Recombinant Protein
AB-P7624
Producto nuevo
Fgf9 (Mouse) Recombinant Protein
Comprando este producto generará 42 Biopuntos. Su cesta contiene un total 42 Biopuntos puede ser convertido en un Biobonos Descuento 168.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | Fgf9 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 9 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Form | Liquid |
| Storage Buffer | In 20 mM Tris, 150 mM NaCl, pH 8.5 (20% glycerol, 5% Trehalose, 1 mM EDTA, 1mM DTT). |
| Gene ID | 14180 |
Más información
Mouse Fgf9 (P54130, 1 a.a. - 208 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.