View larger
Mouse Fgf9 (P54130, 1 a.a. - 208 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</
AB-P7624
New product
Fgf9 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 42 pontos de fidelização. Seu carrinho totalizará 42 pontos de fidelização que podem ser convertidos num vale de desconto de 168.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | Fgf9 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 9 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Form | Liquid |
| Storage Buffer | In 20 mM Tris, 150 mM NaCl, pH 8.5 (20% glycerol, 5% Trehalose, 1 mM EDTA, 1mM DTT). |
| Gene ID | 14180 |
More info
Mouse Fgf9 (P54130, 1 a.a. - 208 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.