CD276 (Human) Recombinant Protein
  • CD276 (Human) Recombinant Protein

CD276 (Human) Recombinant Protein

Ref: AB-P7577
CD276 (Human) Recombinant Protein

Información del producto

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 1 mg
Gene Name CD276
Gene Alias B7-H3|B7H3
Gene Description CD276 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 80381

Enviar un mensaje


CD276 (Human) Recombinant Protein

CD276 (Human) Recombinant Protein