CD276 (Human) Recombinant Protein Ver mas grande

CD276 (Human) Recombinant Protein

AB-P7577

Producto nuevo

CD276 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 26 Biopuntos. Su cesta contiene un total 26 Biopuntos puede ser convertido en un Biobonos Descuento 104.00EUR.


Hoja técnica

Size 1 mg
Gene Name CD276
Gene Alias B7-H3|B7H3
Gene Description CD276 molecule
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 80381

Más información

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.

Consulta sobre un producto

CD276 (Human) Recombinant Protein

CD276 (Human) Recombinant Protein