CD276 (Human) Recombinant Protein View larger

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.

AB-P7577

New product

CD276 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 26 pontos de fidelização. Seu carrinho totalizará 26 pontos de fidelização que podem ser convertidos num vale de desconto de 104.00EUR.


Data sheet

Size 1 mg
Gene Name CD276
Gene Alias B7-H3|B7H3
Gene Description CD276 molecule
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 80381

More info

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.

Enviar uma mensagem

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.

Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.