CD47 (Human) Recombinant Protein Ver mas grande

CD47 (Human) Recombinant Protein

AB-P7569

Producto nuevo

CD47 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 26 Biopuntos. Su cesta contiene un total 26 Biopuntos puede ser convertido en un Biobonos Descuento 104.00EUR.


Hoja técnica

Size 1 mg
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 961

Más información

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.

Consulta sobre un producto

CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein