CD47 (Human) Recombinant Protein View larger

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.

AB-P7569

New product

CD47 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 26 pontos de fidelização. Seu carrinho totalizará 26 pontos de fidelização que podem ser convertidos num vale de desconto de 104.00EUR.


Data sheet

Size 1 mg
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 961

More info

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.

Enviar uma mensagem

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.