CD47 (Human) Recombinant Protein
  • CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein

Ref: AB-P7569
CD47 (Human) Recombinant Protein

Información del producto

Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 1 mg
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 961

Enviar uma mensagem


CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein