TGFB1 (Human) Recombinant Protein
  • TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein

Ref: AB-P7562
TGFB1 (Human) Recombinant Protein

Información del producto

Human TGFB1 (P01137, 279 a.a. - 390 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name TGFB1
Gene Alias CED|DPD1|TGFB|TGFbeta
Gene Description transforming growth factor, beta 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 7040

Enviar un mensaje


TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein