View larger
Human TGFB1 (P01137, 279 a.a. - 390 a.a.) partial recombinant protein expressed in CHO cell.
AB-P7562
New product
TGFB1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | TGFB1 |
| Gene Alias | CED|DPD1|TGFB|TGFbeta |
| Gene Description | transforming growth factor, beta 1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 7040 |
More info
Human TGFB1 (P01137, 279 a.a. - 390 a.a.) partial recombinant protein expressed in CHO cell.