NOG (Human) Recombinant Protein
  • NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein

Ref: AB-P7545
NOG (Human) Recombinant Protein

Información del producto

Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein with hFc tag C-terminus expressed in CHO cell.
Información adicional
Size 1 mg
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 9241

Enviar un mensaje


NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein