Ver mas grande
NOG (Human) Recombinant Protein
AB-P7545
Producto nuevo
NOG (Human) Recombinant Protein
Comprando este producto generará 23 Biopuntos. Su cesta contiene un total 23 Biopuntos puede ser convertido en un Biobonos Descuento 92.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | NOG |
| Gene Alias | SYM1|SYNS1 |
| Gene Description | noggin |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 9241 |
Más información
Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein with hFc tag C-terminus expressed in CHO cell.