View larger
Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein with hFc tag C-terminus expressed in CHO cell.
AB-P7545
New product
NOG (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 23 pontos de fidelização. Seu carrinho totalizará 23 pontos de fidelização que podem ser convertidos num vale de desconto de 92.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | NOG |
| Gene Alias | SYM1|SYNS1 |
| Gene Description | noggin |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 9241 |
More info
Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein with hFc tag C-terminus expressed in CHO cell.