Vegfa (Mouse) Recombinant Protein
  • Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein

Ref: AB-P7528
Vegfa (Mouse) Recombinant Protein

Información del producto

Mouse Vegfa (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed with an N-terminal Met in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Vegfa
Gene Alias Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 22339

Enviar un mensaje


Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein