View larger
Mouse Vegfa (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed with an N-terminal Met in <i>Escherichia coli</
AB-P7528
New product
Vegfa (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Vegfa |
| Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 22339 |
More info
Mouse Vegfa (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed with an N-terminal Met in Escherichia coli.