Cxcl2 (Mouse) Recombinant Protein
  • Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein

Ref: AB-P7516
Cxcl2 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl2 (P10889, 28 a.a. - 100 a.a.) partial recombinant protein expressed in HEK293 cell.
Información adicional
Size 5 ug
Gene Name Cxcl2
Gene Alias CINC-2a|GROb|Gro2|MIP-2|MIP-2a|Mgsa-b|Mip2|Scyb|Scyb2
Gene Description chemokine (C-X-C motif) ligand 2
Storage Conditions Upon reconstitution, store at 4C for up to 1 week or store at -20C up to 3 months.
For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Form Lyophilized
Recomended Dilution Reconstitute the lyophilized powder in ddH?O or PBS up to 100 ug/mL.
Storage Buffer Lyophilized from a 0.2 μm filtered solution in PBS.
Gene ID 20310

Enviar un mensaje


Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein