View larger
Mouse Cxcl2 (P10889, 28 a.a. - 100 a.a.) partial recombinant protein expressed in HEK293 cell.
AB-P7516
New product
Cxcl2 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | Cxcl2 |
| Gene Alias | CINC-2a|GROb|Gro2|MIP-2|MIP-2a|Mgsa-b|Mip2|Scyb|Scyb2 |
| Gene Description | chemokine (C-X-C motif) ligand 2 |
| Storage Conditions | Upon reconstitution, store at 4ºC for up to 1 week or store at -20ºC up to 3 months.<br>For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Form | Lyophilized |
| Recomended Dilution | Reconstitute the lyophilized powder in ddH?O or PBS up to 100 ug/mL. |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution in PBS. |
| Gene ID | 20310 |
More info
Mouse Cxcl2 (P10889, 28 a.a. - 100 a.a.) partial recombinant protein expressed in HEK293 cell.