Ver mas grande
Cntf (Rat) Recombinant Protein
AB-P7507
Producto nuevo
Cntf (Rat) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Cntf |
| Gene Alias | - |
| Gene Description | ciliary neurotrophic factor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 25707 |
Más información
Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.