Cntf (Rat) Recombinant Protein
  • Cntf (Rat) Recombinant Protein

Cntf (Rat) Recombinant Protein

Ref: AB-P7507
Cntf (Rat) Recombinant Protein

Información del producto

Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Cntf
Gene Alias -
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 25707

Enviar uma mensagem


Cntf (Rat) Recombinant Protein

Cntf (Rat) Recombinant Protein