Cntf (Rat) Recombinant Protein View larger

Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7507

New product

Cntf (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name Cntf
Gene Alias -
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 25707

More info

Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Rat Cntf (P20294-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.