Csf1 (Rat) Recombinant Protein Ver mas grande

Csf1 (Rat) Recombinant Protein

AB-P7496

Producto nuevo

Csf1 (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 10 ug
Gene Name Csf1
Gene Alias -
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 78965

Más información

Rat Csf1 (Q8JZQ0-1, 33 a.a. - 186 a.a.) partial recombinant protein expressed at N-terminus in Escherichia coli.

Consulta sobre un producto

Csf1 (Rat) Recombinant Protein

Csf1 (Rat) Recombinant Protein