Csf1 (Rat) Recombinant Protein
  • Csf1 (Rat) Recombinant Protein

Csf1 (Rat) Recombinant Protein

Ref: AB-P7496
Csf1 (Rat) Recombinant Protein

Información del producto

Rat Csf1 (Q8JZQ0-1, 33 a.a. - 186 a.a.) partial recombinant protein expressed at N-terminus in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Csf1
Gene Alias -
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 78965

Enviar uma mensagem


Csf1 (Rat) Recombinant Protein

Csf1 (Rat) Recombinant Protein