VEGFC (Human) Recombinant Protein Ver mas grande

VEGFC (Human) Recombinant Protein

AB-P7485

Producto nuevo

VEGFC (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 10 ug
Gene Name VEGFC
Gene Alias Flt4-L|VRP
Gene Description vascular endothelial growth factor C
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL.
Gene ID 7424

Más información

Human VEGFC (P49767, 112 a.a. - 227 a.a.) partial recombinant protein expressed with an N-terminal Met in HEK293 cells.

Consulta sobre un producto

VEGFC (Human) Recombinant Protein

VEGFC (Human) Recombinant Protein