VEGFC (Human) Recombinant Protein
  • VEGFC (Human) Recombinant Protein

VEGFC (Human) Recombinant Protein

Ref: AB-P7485
VEGFC (Human) Recombinant Protein

Información del producto

Human VEGFC (P49767, 112 a.a. - 227 a.a.) partial recombinant protein expressed with an N-terminal Met in HEK293 cells.
Información adicional
Size 10 ug
Gene Name VEGFC
Gene Alias Flt4-L|VRP
Gene Description vascular endothelial growth factor C
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 7424

Enviar uma mensagem


VEGFC (Human) Recombinant Protein

VEGFC (Human) Recombinant Protein