TNFRSF14 (Human) Recombinant Protein Ver mas grande

TNFRSF14 (Human) Recombinant Protein

AB-P7451

Producto nuevo

TNFRSF14 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.


Hoja técnica

Size 1 mg
Gene Name TNFRSF14
Gene Alias ATAR|HVEA|HVEM|LIGHTR|TR2
Gene Description tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTK
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 8764

Más información

Human TNFRSF14 (Q92956, 39 a.a. - 184 a.a.) partial recombinant protein expressed in Sf9 insect cells.

Consulta sobre un producto

TNFRSF14 (Human) Recombinant Protein

TNFRSF14 (Human) Recombinant Protein