TNFRSF14 (Human) Recombinant Protein View larger

Human TNFRSF14 (Q92956, 39 a.a. - 184 a.a.) partial recombinant protein expressed in Sf9 insect cells.

AB-P7451

New product

TNFRSF14 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.


Data sheet

Size 1 mg
Gene Name TNFRSF14
Gene Alias ATAR|HVEA|HVEM|LIGHTR|TR2
Gene Description tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTK
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 8764

More info

Human TNFRSF14 (Q92956, 39 a.a. - 184 a.a.) partial recombinant protein expressed in Sf9 insect cells.

Enviar uma mensagem

Human TNFRSF14 (Q92956, 39 a.a. - 184 a.a.) partial recombinant protein expressed in Sf9 insect cells.

Human TNFRSF14 (Q92956, 39 a.a. - 184 a.a.) partial recombinant protein expressed in Sf9 insect cells.