HA (Influenza A virus H1N1) Recombinant Protein
  • HA (Influenza A virus H1N1) Recombinant Protein

HA (Influenza A virus H1N1) Recombinant Protein

Ref: AB-P7430
HA (Influenza A virus H1N1) Recombinant Protein

Información del producto

Influenza A virus H1N1 HA (C3W5S1, 35 a.a. - 107 a.a.) partial recombinant protein with His tag expressed in Sf9 insect cells.
Información adicional
Size 10 ug
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Influenza virus
Storage Buffer Lyophilized from a solution in 20 mM PB buffer (pH 7.4), 300 mM NaCl, 5% mannitol, 5% trehalose. Reconstitute the lyophilized powder in ddH2O up to 200 ug/mL.
Gene ID 23308115

Enviar un mensaje


HA (Influenza A virus H1N1) Recombinant Protein

HA (Influenza A virus H1N1) Recombinant Protein