View larger
Influenza A virus H1N1 HA (C3W5S1, 35 a.a. - 107 a.a.) partial recombinant protein with His tag expressed in Sf9 insect cells.
AB-P7430
New product
HA (Influenza A virus H1N1) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 10 ug |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSS |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Influenza virus |
| Storage Buffer | Lyophilized from a solution in 20 mM PB buffer (pH 7.4), 300 mM NaCl, 5% mannitol, 5% trehalose. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 200 ug/mL. |
| Gene ID | 23308115 |
More info
Influenza A virus H1N1 HA (C3W5S1, 35 a.a. - 107 a.a.) partial recombinant protein with His tag expressed in Sf9 insect cells.