Ver mas grande
Ntf4 (Mouse) Recombinant Protein
AB-P7429
Producto nuevo
Ntf4 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | NTF4 |
| Gene Alias | NT-4/5|NT4|NT5|NTF5 |
| Gene Description | neurotrophin 4 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized after extensive dialysis against 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid or ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 4909 |
Más información
Mouse Ntf4 (Q80VU4, 80 a.a. - 209 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.