Ntf4 (Mouse) Recombinant Protein
  • Ntf4 (Mouse) Recombinant Protein

Ntf4 (Mouse) Recombinant Protein

Ref: AB-P7429
Ntf4 (Mouse) Recombinant Protein

Información del producto

Mouse Ntf4 (Q80VU4, 80 a.a. - 209 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name NTF4
Gene Alias NT-4/5|NT4|NT5|NTF5
Gene Description neurotrophin 4
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized after extensive dialysis against 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid or ddH2O up to 100 ug/mL.
Gene ID 4909

Enviar uma mensagem


Ntf4 (Mouse) Recombinant Protein

Ntf4 (Mouse) Recombinant Protein