Csf3 (Mouse) Recombinant Protein
  • Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein

Ref: AB-P7417
Csf3 (Mouse) Recombinant Protein

Información del producto

Mouse Csf3 (P09920, 31 a.a. - 208 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Csf3
Gene Alias Csfg|G-CSF|MGI-IG
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O OR PBS up to 100 ug/mL.
Gene ID 12985

Enviar un mensaje


Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein