View larger
Mouse Csf3 (P09920, 31 a.a. - 208 a.a.) partial recombinant protein expressed in CHO cells.
AB-P7417
New product
Csf3 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Csf3 |
| Gene Alias | Csfg|G-CSF|MGI-IG |
| Gene Description | colony stimulating factor 3 (granulocyte) |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O OR PBS up to 100 ug/mL. |
| Gene ID | 12985 |
More info
Mouse Csf3 (P09920, 31 a.a. - 208 a.a.) partial recombinant protein expressed in CHO cells.