Lep (Rat) Recombinant Protein
  • Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein

Ref: AB-P7414
Lep (Rat) Recombinant Protein

Información del producto

Rat Lep (P50596, 22 a.a. - 167 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.
Información adicional
Size 5 mg
Gene Name Lep
Gene Alias OB|obese
Gene Description leptin
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 25608

Enviar un mensaje


Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein