View larger
Rat Lep (P50596, 22 a.a. - 167 a.a.) partial recombinant protein with an N-terminal Met expressed in <i>Escherichia coli</i>.
AB-P7414
New product
Lep (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 5 mg |
| Gene Name | Lep |
| Gene Alias | OB|obese |
| Gene Description | leptin |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 25608 |
More info
Rat Lep (P50596, 22 a.a. - 167 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.