Fgf10 (Mouse) Recombinant Protein Ver mas grande

Fgf10 (Mouse) Recombinant Protein

AB-P7411

Producto nuevo

Fgf10 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 10 ug
Gene Name Fgf10
Gene Alias BB213776|FGF-10
Gene Description fibroblast growth factor 10
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 14165

Más información

Mouse Fgf10 (O35565, 62 a.a. - 209 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Fgf10 (Mouse) Recombinant Protein

Fgf10 (Mouse) Recombinant Protein