Fgf10 (Mouse) Recombinant Protein
  • Fgf10 (Mouse) Recombinant Protein

Fgf10 (Mouse) Recombinant Protein

Ref: AB-P7411
Fgf10 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf10 (O35565, 62 a.a. - 209 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf10
Gene Alias BB213776|FGF-10
Gene Description fibroblast growth factor 10
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 14165

Enviar uma mensagem


Fgf10 (Mouse) Recombinant Protein

Fgf10 (Mouse) Recombinant Protein