Il5 (Rat) Recombinant Protein
  • Il5 (Rat) Recombinant Protein

Il5 (Rat) Recombinant Protein

Ref: AB-P7353
Il5 (Rat) Recombinant Protein

Información del producto

Rat Il5 (Q08125, 20 a.a. - 132 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il5
Gene Alias -
Gene Description interleukin 5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from 20 mM Tris, pH 8.5. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 24497

Enviar un mensaje


Il5 (Rat) Recombinant Protein

Il5 (Rat) Recombinant Protein