View larger
Rat Il5 (Q08125, 20 a.a. - 132 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7353
New product
Il5 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Il5 |
| Gene Alias | - |
| Gene Description | interleukin 5 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 20 mM Tris, pH 8.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 24497 |
More info
Rat Il5 (Q08125, 20 a.a. - 132 a.a.) partial recombinant protein expressed in Escherichia coli.