S100A1 (Human) Recombinant Protein
  • S100A1 (Human) Recombinant Protein

S100A1 (Human) Recombinant Protein

Ref: AB-P7349
S100A1 (Human) Recombinant Protein

Información del producto

Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name S100A1
Gene Alias S100|S100-alpha|S100A
Gene Description S100 calcium binding protein A1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Form Lyophilized
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH2O at 200 μg/ml. 
Gene ID 6271

Enviar un mensaje


S100A1 (Human) Recombinant Protein

S100A1 (Human) Recombinant Protein