AB-P7349
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 5 ug |
Gene Name | S100A1 |
Gene Alias | S100|S100-alpha|S100A |
Gene Description | S100 calcium binding protein A1 |
Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Form | Lyophilized |
Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Storage Buffer | Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O at 200 μg/ml. |
Gene ID | 6271 |