View larger
Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7349
New product
S100A1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | S100A1 |
| Gene Alias | S100|S100-alpha|S100A |
| Gene Description | S100 calcium binding protein A1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
| Form | Lyophilized |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O at 200 μg/ml. |
| Gene ID | 6271 |
More info
Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli.