Ver mas grande
IFNG (Human) Recombinant Protein
AB-P7260
Producto nuevo
IFNG (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IFNG |
| Gene Alias | IFG|IFI |
| Gene Description | interferon, gamma |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Form | Lyophilized |
| Quality control testing | 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 3458 |
Más información
Human IFNG (P01579, 24 a.a. - 166 a.a.) partial recombinant protein expressed in Escherichia coli.