IFNG (Human) Recombinant Protein
  • IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein

Ref: AB-P7260
IFNG (Human) Recombinant Protein

Información del producto

Human IFNG (P01579, 24 a.a. - 166 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Form Lyophilized
Quality control testing 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 3458

Enviar uma mensagem


IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein