Ver mas grande
CCL21 (Human) Recombinant Protein
AB-P7219
Producto nuevo
CCL21 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCL21 |
| Gene Alias | 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4 |
| Gene Description | chemokine (C-C motif) ligand 21 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 6366 |
Más información
Human CCL21 (O00585, 24 a.a. - 134 a.a.) partial recombinant protein expressed in Escherichia coli.