CCL21 (Human) Recombinant Protein
  • CCL21 (Human) Recombinant Protein

CCL21 (Human) Recombinant Protein

Ref: AB-P7219
CCL21 (Human) Recombinant Protein

Información del producto

Human CCL21 (O00585, 24 a.a. - 134 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL21
Gene Alias 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4
Gene Description chemokine (C-C motif) ligand 21
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 6366

Enviar uma mensagem


CCL21 (Human) Recombinant Protein

CCL21 (Human) Recombinant Protein