CCL5 (Human) Recombinant Protein
  • CCL5 (Human) Recombinant Protein

CCL5 (Human) Recombinant Protein

Ref: AB-P7209
CCL5 (Human) Recombinant Protein

Información del producto

Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL5
Gene Alias D17S136E|MGC17164|RANTES|SCYA5|SISd|TCP228
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 6352

Enviar un mensaje


CCL5 (Human) Recombinant Protein

CCL5 (Human) Recombinant Protein