View larger
Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7209
New product
CCL5 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCL5 |
| Gene Alias | D17S136E|MGC17164|RANTES|SCYA5|SISd|TCP228 |
| Gene Description | chemokine (C-C motif) ligand 5 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 6352 |
More info
Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.