Ver mas grande
DEFB1 (Human) Recombinant Protein
AB-P7171
Producto nuevo
DEFB1 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | DEFB1 |
| Gene Alias | BD1|DEFB-1|DEFB101|HBD1|MGC51822 |
| Gene Description | defensin, beta 1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 1672 |
Más información
Human DEFB1 (P60022, 22 a.a. - 68 a.a.) partial recombinant protein expressed in Escherichia coli.