DEFB1 (Human) Recombinant Protein
  • DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein

Ref: AB-P7171
DEFB1 (Human) Recombinant Protein

Información del producto

Human DEFB1 (P60022, 22 a.a. - 68 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name DEFB1
Gene Alias BD1|DEFB-1|DEFB101|HBD1|MGC51822
Gene Description defensin, beta 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 1672

Enviar uma mensagem


DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein