Ver mas grande
IL20 (Human) Recombinant Protein
AB-P7156
Producto nuevo
IL20 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL20 |
| Gene Alias | IL-20|IL10D|MGC96907|ZCYTO10 |
| Gene Description | interleukin 20 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 50604 |
Más información
Human IL20 (Q9NYY1, 25 a.a. - 176 a.a.) partial recombinant protein expressed in Escherichia coli.