IL20 (Human) Recombinant Protein
  • IL20 (Human) Recombinant Protein

IL20 (Human) Recombinant Protein

Ref: AB-P7156
IL20 (Human) Recombinant Protein

Información del producto

Human IL20 (Q9NYY1, 25 a.a. - 176 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL20
Gene Alias IL-20|IL10D|MGC96907|ZCYTO10
Gene Description interleukin 20
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 50604

Enviar uma mensagem


IL20 (Human) Recombinant Protein

IL20 (Human) Recombinant Protein