KITLG (Human) Recombinant Protein
  • KITLG (Human) Recombinant Protein

KITLG (Human) Recombinant Protein

Ref: AB-P7148
KITLG (Human) Recombinant Protein

Información del producto

Human KITLG (P21583-1, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris.
Información adicional
Size 10 ug
Gene Name KITLG
Gene Alias DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7
Gene Description KIT ligand
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 4254

Enviar un mensaje


KITLG (Human) Recombinant Protein

KITLG (Human) Recombinant Protein