View larger
Human KITLG (P21583-1, 26 a.a. - 189 a.a.) partial recombinant protein expressed in <i>Pichia pastoris</i>.
AB-P7148
New product
KITLG (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | KITLG |
| Gene Alias | DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7 |
| Gene Description | KIT ligand |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 4254 |
More info
Human KITLG (P21583-1, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris.