COL18A1 (Human) Recombinant Protein Ver mas grande

COL18A1 (Human) Recombinant Protein

AB-P7141

Producto nuevo

COL18A1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name COL18A1
Gene Alias FLJ27325|FLJ34914|KNO|KNO1|MGC74745
Gene Description collagen, type XVIII, alpha 1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 80781

Más información

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in Pichia pastoris.

Consulta sobre un producto

COL18A1 (Human) Recombinant Protein

COL18A1 (Human) Recombinant Protein