COL18A1 (Human) Recombinant Protein
  • COL18A1 (Human) Recombinant Protein

COL18A1 (Human) Recombinant Protein

Ref: AB-P7141
COL18A1 (Human) Recombinant Protein

Información del producto

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in Pichia pastoris.
Información adicional
Size 100 ug
Gene Name COL18A1
Gene Alias FLJ27325|FLJ34914|KNO|KNO1|MGC74745
Gene Description collagen, type XVIII, alpha 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 80781

Enviar un mensaje


COL18A1 (Human) Recombinant Protein

COL18A1 (Human) Recombinant Protein