COL18A1 (Human) Recombinant Protein View larger

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in <i>Pichia pastoris</i>.

AB-P7141

New product

COL18A1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name COL18A1
Gene Alias FLJ27325|FLJ34914|KNO|KNO1|MGC74745
Gene Description collagen, type XVIII, alpha 1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 80781

More info

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in Pichia pastoris.

Enviar uma mensagem

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in <i>Pichia pastoris</i>.

Human COL18A1 (P39060, 1571 a.a. - 1754 a.a.) partial recombinant protein expressed in <i>Pichia pastoris</i>.